These should typically be used to import NGS sequence data e.g from Illumina, Ion Torrent, 454 and PacBio sequencers. >gi|532319|pir|TVFV2E|TVFV2E envelope proteinĮLRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRTĬTACCCCCCTAAAACACTTTGAAGCCTGATCCTCACTA-CTGTįASTQ format stores sequences and Phred qualities in a single file. Here is an example of three sequences in FASTA format (DNA, Protein, Aligned DNA):ĪTGGCTTGTGGTCTGGTCGCCAGCAACCTGAATCTCAAACCTGGAGAGTGCCTTCGAGTG An empty line may or may not separate consecutive sequences. The sequence data may span multiple lines and these sequence may contain gap characters. Each sequence in a FASTA file has a header line beginning with a “ >” followed by a number of lines containing the raw protein or DNA sequence data. The FASTA file format is commonly used by many programs and tools, including BLAST, T-Coffee and ClustalX. Geneious can interoperate with EndNote using Endnote’s XML (Extensible Markup Language) file format to export and import its files. It also generates a bibliography in different styles. EndNote lets you search for journal articles online, import citations, perform searches on your own notes, and insert references into documents. Nucleotide sequences from the EMBL Nucleotide Sequence Database, and protein sequences from UniProt (the Universal Protein Resource)ĮndNote is a popular reference and bibliography manager.
Sequence files generated by the Mac program DNA Strider, containing one Nucleotide or Protein sequence. pro files are used in Lasergene, a sequence analysis tool produced by DNAStar. csfasta files represent the color calls generated by the SOLiD sequencing system.ĭNAStar. Seq7 P-KGANYFVYKLD-RPKFSSDRCGHNYNGDP-LTNLDYVPQYLRWSDEĪBI. Seq6 P-GNAQYFRNACS-EGKTATKGKCRCISGDP-PTYFDYVPQYLRWSEE Seq5 DKGNA-YFRATCNSADGKSQSQARNQCRC-KDENGXN-ADQVPTYFDYVPQYLRWSEE Seq4 DKGNA-YFRRTCNSADGKSQSQARNQCRC-KDENGKN-ADQVPTYFDYVPQYLRWSEE Seq3 KLSNASYFRATC-SDGQSGAQANNYCRCNGDKPDDDKP-NTDPPTYFDYVPQYLRWSEE Seq1 -GGGKYFRNTCDG-GQNPTETQNNCRCIG-ATVPTYFDYVPQYLRWSDE Seq6 -FSKNIX-QIEELQDEWLLEARYKD-TDNYYELREHWWTENRHTVWEALTCEA Seq5 -NVAALKTRYEK-DGQNFYQLREDWWTANRATIWEAITCSA Seq4 -SQRHYKD-DGGNYFQLREDWWTANRHTVWEAITCSA Seq3 -KRIYKKIFKEIHSGLSTKNGVKDRYQN-DGDNYFQLREDWWTANRSTVWKALTCSD Seq2 -YEGLTTANGXKEYYQDKNGGNFFKLREDWWTANRETVWKAITCGA Seq1 -KSKERYKDENGGNYFQLREDWWDANRETVWKAITCNA An example Clustal file:ĬLUSTAL W (1.74) multiple sequence alignment The Clustal format is used by ClustalW and ClustalX, two well known multiple sequence alignment programs.Ĭlustal format files are used to store multiple sequence alignments and contain the word clustal at the beginning. pd4 are not not currently supported for import. Currently it does not import other fields, restriction cut sites or primer binding sites. This will import name, description, topology, sequence and annotations. Geneious can import annotated sequences files in the standard Clone Manager molecule format. You can use a BED file to annotate existing sequences in your local database, import entirely new sequences, or import the annotations onto blank sequences. The BED format contains sequence annotation information. CSV/TSV (Comma/Tab Separated Values) sequences